PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Spipo2G0015800
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Alismatales; Araceae; Lemnoideae; Spirodela
Family CPP
Protein Properties Length: 643aa    MW: 70376.4 Da    PI: 6.4098
Description CPP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Spipo2G0015800genomeMIPS/IBISView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCR48.81.4e-15332368339
             TCR   3 kkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNk 39 
                     +k+C+CkkskClk+YCeCfaag +C  +C+C+dC Nk
  Spipo2G0015800 332 CKRCKCKKSKCLKLYCECFAAGLYCVGSCECQDCLNK 368
                     799*********************************8 PP

2TCR52.11.3e-16416455140
             TCR   1 kekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNke 40 
                     ++k+gCnCkks+ClkkYCeC++ g+ Cs +C+Ce+C+N+ 
  Spipo2G0015800 416 RHKRGCNCKKSRCLKKYCECYQGGVGCSPSCRCEGCMNTF 455
                     589***********************************86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM011144.1E-13330371IPR033467Tesmin/TSO1-like CXC domain
PROSITE profilePS5163435.937331456IPR005172CRC domain
PfamPF036383.7E-11333368IPR005172CRC domain
SMARTSM011141.2E-16416457IPR033467Tesmin/TSO1-like CXC domain
PfamPF036383.1E-12418454IPR005172CRC domain
Sequence ? help Back to Top
Protein Sequence    Length: 643 aa     Download sequence    Send to blast
MGNSDLDQFG CNRQEERQPS LTEINFKISE LPSQEQSREK PTGRNWDLII DDDDNFLIFD  60
SSPESQACKK HNQLMRNHVA AYSALSSSNL SKSNNDDLQE MRPDDFLCVC SSPRNPTVHL  120
PKDDNLEVDG KVHTELIPQA PLTCCKKPVN GGLSEKMDAE AGDCVSLRFQ VGEPHHRGMR  180
RRCLVFEMGG SHGQNMLCEP ETNTPPSLSP SVNLTPGDGQ QPFFKPCLGP QATVVPGIGL  240
HLNSLATISK ESISAEDPFS NETQSGTAVQ KHPSVSIKIE RDDMCCGSEI QDLASTQDSF  300
QVPATSCGDS FNPGSPVKEI DKAESGGETG GCKRCKCKKS KCLKLYCECF AAGLYCVGSC  360
ECQDCLNKPI YEDTVLAARK LIESRNPLAF APKVIRTSEP TTEICEDTNK TPASARHKRG  420
CNCKKSRCLK KYCECYQGGV GCSPSCRCEG CMNTFGKRDD PLPFGGHGIV LEEEFHATDK  480
DDPQHDFGRR HKDGKPFSES VLPITPASQI RRSFVRPPFF STVKPPRASL RTVGSSPLNT  540
EQIPAKPTLD EHLLVNSEDE MPDILSHSLM STISPSRKRV SPPHHGINLS PSRKGGRKLI  600
LRAIPSLPPL TTDSVDELRP SVVELRLVAG DEEEAYGGLS CR*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP61473447
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G22780.14e-77Tesmin/TSO1-like CXC domain-containing protein